Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRTN Peptide - middle region

SPRTN Peptide - middle region

Product Specifications

Product Name Alternative

C1orf124, DDDL1880, PRO4323, Spartan, dJ876B10.3

UniProt

Q9H040

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRTN Rabbit Polyclonal Antibody (orb326824) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_114407

Preservative

Lyophilized powder

AA Sequence

ATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nerve Growth Factor, beta, , Recombinant, Rat, aa122-241 (NGFB, beta-NGF, Nerve Growth Factor, 2.5S NGF)
145718 25 µg

Nerve Growth Factor, beta, , Recombinant, Rat, aa122-241 (NGFB, beta-NGF, Nerve Growth Factor, 2.5S NGF)

Sign In for Pricing
View Details
Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit
MBS7222831-01 48 Well

Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit
MBS7222831-02 96 Well

Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit
MBS7222831-03 5x 96 Well

Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit

Sign In for Pricing
View Details
Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit
MBS7222831-04 10x 96 Well

Porcine Olfactory receptor 52N2 (OR52N2) ELISA Kit

Sign In for Pricing
View Details
NUP160 ORF Vector (Human) (pORF)
32319012 1.0 µg DNA

NUP160 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details