Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYDE2 Peptide - C-terminal region

SYDE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-33E12.1

UniProt

Q5VT97

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYDE2 Rabbit Polyclonal Antibody (orb326825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115560

Preservative

Lyophilized powder

AA Sequence

KENLNDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPIPMSKECTFQTYLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIPK (NM_001080518) Human Over-expression Lysate
LY421073 100 µg

LIPK (NM_001080518) Human Over-expression Lysate

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), 1mg/mL
BNUM0668-50 1x 50 µL

MART-1 / Melan-A (A103), 1mg/mL

Sign In for Pricing
View Details
ProPette™ LE Single Channel Pipettor
P5200-5M 1 Each

ProPette™ LE Single Channel Pipettor

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS804098 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF568 conjugate, 0.1mg/mL
BNC683795-500 1x 500 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Rgs4 activation kit by CRISPRa
GA203634 1 Kit

Mouse Rgs4 activation kit by CRISPRa

Sign In for Pricing
View Details