Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYDE2 Peptide - C-terminal region

SYDE2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RP11-33E12.1

UniProt

Q5VT97

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SYDE2 Rabbit Polyclonal Antibody (orb326825) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115560

Preservative

Lyophilized powder

AA Sequence

KENLNDVDYDDVPSEDRKIGENYSKMDGPEVMIEQPIPMSKECTFQTYLT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)
KN201278 1 Kit

Chk2 (CHEK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL
BNC742409-500 1x 500 µL

STAT3 / Signal Transducer and Activator of Transcription 3 (STAT3/2409), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KIRREL2 Human Gene Knockout Kit (CRISPR)
KN415296 1 Kit

KIRREL2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GANAB Recombinant Rabbit Monoclonal Antibody [PSH01-53]
HA721696 100 µL

GANAB Recombinant Rabbit Monoclonal Antibody [PSH01-53]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary: right
CB500853 1 Block

Frozen Tissue Blocks, Ovary: right

Sign In for Pricing
View Details