Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UQCC2 Peptide - C-terminal region

UQCC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

M19, Cbp6, MNF1, C6orf125, C6orf126, bA6B20.2

UniProt

Q9BRT2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UQCC2 Rabbit Polyclonal Antibody (orb587157) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115716

Preservative

Lyophilized powder

AA Sequence

DTSFSGLSLEEYKLILSTDTLEELKEIDKGMWKKLQEKFAPKGPEEDHKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Human CD63
MBS8559213-01 0.1 mL

Mouse Human CD63

Sign In for Pricing
View Details
Mouse Human CD63
MBS8559213-02 0.1 mL (AF405L)

Mouse Human CD63

Sign In for Pricing
View Details
Mouse Human CD63
MBS8559213-03 0.1 mL (AF405S)

Mouse Human CD63

Sign In for Pricing
View Details
Mouse Human CD63
MBS8559213-04 0.1 mL (AF610)

Mouse Human CD63

Sign In for Pricing
View Details
Mouse Human CD63
MBS8559213-05 0.1 mL (AF635)

Mouse Human CD63

Sign In for Pricing
View Details
Mouse Human CD63
MBS8559213-06 0.1 mL (APC)

Mouse Human CD63

Sign In for Pricing
View Details