Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3HYPDH Peptide - C-terminal region

L3HYPDH Peptide - C-terminal region

Product Specifications

UniProt

Q96EM0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with L3HYPDH Rabbit Polyclonal Antibody (orb587199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653182

Preservative

Lyophilized powder

AA Sequence

AFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospholipase A2 IIA (PLA2G2A) Mouse Monoclonal Antibody [Clone ID: OTI1C2]
CF808040 100 µg

Phospholipase A2 IIA (PLA2G2A) Mouse Monoclonal Antibody [Clone ID: OTI1C2]

Sign In for Pricing
View Details
Aprataxin (APTX) (NM_001195250) Human Over-expression Lysate
LY434146 100 µg

Aprataxin (APTX) (NM_001195250) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS501151 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Recombinant CD127 Antibody
RC-16070-01 50 μL

Recombinant CD127 Antibody

Sign In for Pricing
View Details
Recombinant CD127 Antibody
RC-16070-02 100 µL

Recombinant CD127 Antibody

Sign In for Pricing
View Details
Recombinant CD127 Antibody
RC-16070-03 1 mL

Recombinant CD127 Antibody

Sign In for Pricing
View Details