Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3HYPDH Peptide - C-terminal region

L3HYPDH Peptide - C-terminal region

Product Specifications

UniProt

Q96EM0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with L3HYPDH Rabbit Polyclonal Antibody (orb587199) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653182

Preservative

Lyophilized powder

AA Sequence

AFKSSATGSVFTGKAVREAKCGDFKAVIVEVSGQAHYTGTASFIIEDDDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI2D5]
CF806242 100 µg

Retinoic Acid Receptor alpha (RARA) Mouse Monoclonal Antibody [Clone ID: OTI2D5]

Sign In for Pricing
View Details
Tissue FFPE Sections, Meninges
CS713795 5x 5 µm

Tissue FFPE Sections, Meninges

Sign In for Pricing
View Details
Zfp536 Mouse Gene Knockout Kit (CRISPR)
KN519874 1 Kit

Zfp536 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zfp759 Mouse Gene Knockout Kit (CRISPR)
KN519967 1 Kit

Zfp759 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rchy1 Mouse Gene Knockout Kit (CRISPR)
KN514612 1 Kit

Rchy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRP1-mediated Endocytosis and Transmission of Tau Antibody Sampler Kit
HAK21098 1 Kit

LRP1-mediated Endocytosis and Transmission of Tau Antibody Sampler Kit

Sign In for Pricing
View Details