Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD22 Peptide - N-terminal region

ANKRD22 Peptide - N-terminal region

Product Specifications

UniProt

Q5VYY1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD22 Rabbit Polyclonal Antibody (orb587209) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653191

Preservative

Lyophilized powder

AA Sequence

CRRGHVRIVSFLLRRNANVNLKNQKERTCLHYAVKKKFTFIDYLLIILLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAK6 (NM_020168) Human Over-expression Lysate
LC402760 20 µg

PAK6 (NM_020168) Human Over-expression Lysate

Sign In for Pricing
View Details
NAPSIN A (NAPSA) Mouse Monoclonal Antibody [Clone ID: OTI3A4]
CF808773 100 µg

NAPSIN A (NAPSA) Mouse Monoclonal Antibody [Clone ID: OTI3A4]

Sign In for Pricing
View Details
(S)-3-Aminobutan-1-ol
TRC-A601888-5G 5 g

(S)-3-Aminobutan-1-ol

Sign In for Pricing
View Details
SLC24A4 Antibody
8C18849-AAT 50 µg

SLC24A4 Antibody

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF594 conjugate, 0.1mg/mL
BNC941019-500 1x 500 µL

CD50 (ICAM-3) (ICAM3/1019), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CLOCK (Center) Rabbit Polyclonal Antibody
AP14237PU-N 400 µL

CLOCK (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details