Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER1L6-AS2 Peptide - middle region

FER1L6-AS2 Peptide - middle region

Product Specifications

Product Name Alternative

C8orf78

UniProt

Q96M78

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FER1L6-AS2 Rabbit Polyclonal Antibody (orb326880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872331

Preservative

Lyophilized powder

AA Sequence

ELHLLHFPNSPEENLRKRPAEPSPQIHGGAPHLPWLCVEKSDLLPENHAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prohibitin Rabbit Monoclonal Antibody [KD Validated]
E46F68311 40 µL

Prohibitin Rabbit Monoclonal Antibody [KD Validated]

Sign In for Pricing
View Details
Psmb3 (NM_011971) Mouse Tagged ORF Clone
MG202155 10 µg

Psmb3 (NM_011971) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Insulin
HAR048-3ml 3 mL

Insulin

Sign In for Pricing
View Details
Human BSG/Basigin ELISA Kit
E0296Hu 96 Tests

Human BSG/Basigin ELISA Kit

Sign In for Pricing
View Details
GBX2 Protein Vector (Mouse) (pPB-N-His)
PV181447 500 ng

GBX2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
CDC25B Blocking Peptide
33R-9253 100 ug

CDC25B Blocking Peptide

Sign In for Pricing
View Details