Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER1L6-AS2 Peptide - middle region

FER1L6-AS2 Peptide - middle region

Product Specifications

Product Name Alternative

C8orf78

UniProt

Q96M78

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FER1L6-AS2 Rabbit Polyclonal Antibody (orb326880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872331

Preservative

Lyophilized powder

AA Sequence

ELHLLHFPNSPEENLRKRPAEPSPQIHGGAPHLPWLCVEKSDLLPENHAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6811-5p miRNA Antagomir
CIJ2285-01 10 nmol

Hsa-miR-6811-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-6811-5p miRNA Antagomir
CIJ2285-02 20 nmol

Hsa-miR-6811-5p miRNA Antagomir

Sign In for Pricing
View Details
VAMP5 (Vesicle-associated Membrane Protein 5, VAMP-5, Myobrevin, HSPC191) (MaxLight 550)
135198-ML550 100 µL

VAMP5 (Vesicle-associated Membrane Protein 5, VAMP-5, Myobrevin, HSPC191) (MaxLight 550)

Sign In for Pricing
View Details
Transgelin / SM22-alpha (TAGLN/247), CF740 conjugate, 0.1mg/mL
BNC740247-500 1x 500 µL

Transgelin / SM22-alpha (TAGLN/247), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Interleukin 13 (IL13) CLIA Kit
abx195851 96 Tests

Human Interleukin 13 (IL13) CLIA Kit

Sign In for Pricing
View Details
Anti-Mouse THBS1 Polyclonal Antibody
PMC29401 100 μg

Anti-Mouse THBS1 Polyclonal Antibody

Sign In for Pricing
View Details