Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FER1L6-AS2 Peptide - middle region

FER1L6-AS2 Peptide - middle region

Product Specifications

Product Name Alternative

C8orf78

UniProt

Q96M78

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FER1L6-AS2 Rabbit Polyclonal Antibody (orb326880) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872331

Preservative

Lyophilized powder

AA Sequence

ELHLLHFPNSPEENLRKRPAEPSPQIHGGAPHLPWLCVEKSDLLPENHAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WBSCR28 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
50288065 1.0 µg DNA

WBSCR28 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Alpha Tubulin antibody
10R-6523-01 0.025 mg

Alpha Tubulin antibody

Sign In for Pricing
View Details
Alpha Tubulin antibody
10R-6523-02 0.1 mg

Alpha Tubulin antibody

Sign In for Pricing
View Details
Nuf2 (NM_001012028) Rat Tagged ORF Clone Lentiviral Particle
RR201334L3V 200 µL

Nuf2 (NM_001012028) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ROM1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-15475 0.1 mg

ROM1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
TFF3/Trefoil Factor 3 Protein (His Tag)
600-253-L1000 1000 µg

TFF3/Trefoil Factor 3 Protein (His Tag)

Sign In for Pricing
View Details