PLD6 Peptide - C-terminal region
PLD6 Peptide - C-terminal region
Product Specifications
UniProt
Q8N2A8
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLD6 Rabbit Polyclonal Antibody (orb587248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_849158
Preservative
Lyophilized powder
AA Sequence
ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Cyclin H Mouse Monoclonal Antibody [Clone ID: AT3G6]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd92d/imageurl/am50623pu-s.webp)
AM50623PU-S 50 µL
Cyclin H Mouse Monoclonal Antibody [Clone ID: AT3G6]
Sign In for Pricing
View Details 
TRC-S688860-25MG 25 mg
N-(2-Succinyl) Phenylephrine 2,3'-O-Dibenzyl Ether 1,4-Dibenzyl Ester
Sign In for Pricing
View Details 
HAF-443-1 1 mL
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Mouse IgG (min.x Hu., Bov., Eq.)
Sign In for Pricing
View Details 