Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLD6 Peptide - C-terminal region

PLD6 Peptide - C-terminal region

Product Specifications

UniProt

Q8N2A8

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLD6 Rabbit Polyclonal Antibody (orb587248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849158

Preservative

Lyophilized powder

AA Sequence

ITEDDEYVRLFLEEFERIWEQFNPTKYTFFPPKKSHGSCAPPVSRAGGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Green Fluorescent FAM-FLICA® Caspase-9 (LEHD) Assay Kit
912 25 Tests

Green Fluorescent FAM-FLICA® Caspase-9 (LEHD) Assay Kit

Sign In for Pricing
View Details
STAT6 Human Knockdown Lysate
LY300435 100 µg

STAT6 Human Knockdown Lysate

Sign In for Pricing
View Details
EGLN1 / PHD2 (366G/76/3), CF405S conjugate, 0.1mg/mL
BNC043074-100 1x 100 µL

EGLN1 / PHD2 (366G/76/3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Pancreas
CP629168 150 µg

Tissue Protein Lysate, Pancreas

Sign In for Pricing
View Details
Texas Red Conjugated lris hybrid Lectin (Dutch Iris) -IRA-
T-8010-1 1 mg

Texas Red Conjugated lris hybrid Lectin (Dutch Iris) -IRA-

Sign In for Pricing
View Details
JUN Polyclonal Antibody
E-AB-70371-01 60 µL

JUN Polyclonal Antibody

Sign In for Pricing
View Details