Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6Q1 Peptide - C-terminal region

OR6Q1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-226

UniProt

Q8NGQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6Q1 Rabbit Polyclonal Antibody (orb587258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005186

Preservative

Lyophilized powder

AA Sequence

FFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS707632 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Chromodomain helicase DNA binding protein 5 (CHD5) Human Gene Knockout Kit (CRISPR)
KN417757 1 Kit

Chromodomain helicase DNA binding protein 5 (CHD5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Human FOLH1 Antibody[107-1A4]
AN004840P-01 25 µg

Purified Anti-Human FOLH1 Antibody[107-1A4]

Sign In for Pricing
View Details
Purified Anti-Human FOLH1 Antibody[107-1A4]
AN004840P-02 100 µg

Purified Anti-Human FOLH1 Antibody[107-1A4]

Sign In for Pricing
View Details
IL-4 / Interleukin 4 (IL4/1597), 0.2mg/mL
BNUB1597-500 1x 500 µL

IL-4 / Interleukin 4 (IL4/1597), 0.2mg/mL

Sign In for Pricing
View Details
Human PARP9 activation kit by CRISPRa
GA113231 1 Kit

Human PARP9 activation kit by CRISPRa

Sign In for Pricing
View Details