Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6Q1 Peptide - C-terminal region

OR6Q1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-226

UniProt

Q8NGQ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6Q1 Rabbit Polyclonal Antibody (orb587258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005186

Preservative

Lyophilized powder

AA Sequence

FFMYVQTKVTSSINFNKVVSVFYSVVTPMLNPLIYSLRNKEVKGALGRVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phenobarbital 1-Diethyl Butyrate
TRC-P316880-10MG 10 mg

Phenobarbital 1-Diethyl Butyrate

Sign In for Pricing
View Details
Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit
E-EL-H2069-01 24 Tests

Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit

Sign In for Pricing
View Details
Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit
E-EL-H2069-02 48 Tests

Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit

Sign In for Pricing
View Details
Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit
E-EL-H2069-03 96 Tests

Human CTLA4 (Cytotoxic T-Lymphocyte Associated Antigen 4) ELISA Kit

Sign In for Pricing
View Details
Ombitasvir
TRC-O633200-2.5MG 2.5 mg

Ombitasvir

Sign In for Pricing
View Details
Bmi1 (COMMD3-BMI1) Goat Polyclonal Antibody
AP07560PU-N 50 µg

Bmi1 (COMMD3-BMI1) Goat Polyclonal Antibody

Sign In for Pricing
View Details