Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf136 Peptide - middle region

C6orf136 Peptide - middle region

Product Specifications

UniProt

Q5SQH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C6orf136 Rabbit Polyclonal Antibody (orb587261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103408

Preservative

Lyophilized powder

AA Sequence

CPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigment Red 23 (tech grade)
TRC-P437790-500MG 500 mg

Pigment Red 23 (tech grade)

Sign In for Pricing
View Details
C14orf166B (LRRC74A) (NM_001081002) Human Over-expression Lysate
LY421148 100 µg

C14orf166B (LRRC74A) (NM_001081002) Human Over-expression Lysate

Sign In for Pricing
View Details
5-Hexyn-1-ol
TRC-H325250-1G 1 g

5-Hexyn-1-ol

Sign In for Pricing
View Details
2-Propionylbenzoic Acid
TRC-P839045-500MG 500 mg

2-Propionylbenzoic Acid

Sign In for Pricing
View Details
Mouse Art5 activation kit by CRISPRa
GA200289 1 Kit

Mouse Art5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: right
CS700799 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details