Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C6orf136 Peptide - middle region

C6orf136 Peptide - middle region

Product Specifications

UniProt

Q5SQH8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C6orf136 Rabbit Polyclonal Antibody (orb587261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001103408

Preservative

Lyophilized powder

AA Sequence

CPYPGAWIPFQVPGTAHPSPATPSGDPSMEEHLSVMYERLRQELPKLFLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMC8 Polyclonal Antibody
E-AB-14013-01 20 µL

EMC8 Polyclonal Antibody

Sign In for Pricing
View Details
EMC8 Polyclonal Antibody
E-AB-14013-02 60 µL

EMC8 Polyclonal Antibody

Sign In for Pricing
View Details
EMC8 Polyclonal Antibody
E-AB-14013-03 120 µL

EMC8 Polyclonal Antibody

Sign In for Pricing
View Details
EMC8 Polyclonal Antibody
E-AB-14013-04 200 µL

EMC8 Polyclonal Antibody

Sign In for Pricing
View Details
2-Mercaptoethanol
TRC-M225480-50G 50 g

2-Mercaptoethanol

Sign In for Pricing
View Details
CHCHD3 Rabbit Polyclonal Antibody
TA365634 100 µL

CHCHD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details