Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC75 Peptide - N-terminal region

CCDC75 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CENP-Y, CENPY, GPATCH11, CCDC75

UniProt

Q8N954

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC75 Rabbit Polyclonal Antibody (orb587264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777591

Preservative

Lyophilized powder

AA Sequence

DSFINVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2A/MEF2C Antibody, mAb, Rabbit
A03695-100 100 µL

MEF2A/MEF2C Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Vascular Endothelial Growth Inhibitor Protein
abx260728-01 5 µg

Vascular Endothelial Growth Inhibitor Protein

Sign In for Pricing
View Details
Vascular Endothelial Growth Inhibitor Protein
abx260728-02 20 µg

Vascular Endothelial Growth Inhibitor Protein

Sign In for Pricing
View Details
Vascular Endothelial Growth Inhibitor Protein
abx260728-03 1 mg

Vascular Endothelial Growth Inhibitor Protein

Sign In for Pricing
View Details
ZNF253 CRISPR All-in-one AAV vector set (with saCas9)(Human)
51385151 3x 1.0 µg DNA

ZNF253 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Canine Aldolase (ALD) ELISA Kit
MBS9397316-01 48 Well

Canine Aldolase (ALD) ELISA Kit

Sign In for Pricing
View Details