Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC75 Peptide - N-terminal region

CCDC75 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CENP-Y, CENPY, GPATCH11, CCDC75

UniProt

Q8N954

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC75 Rabbit Polyclonal Antibody (orb587264) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_777591

Preservative

Lyophilized powder

AA Sequence

DSFINVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT14 Antibody
orb1288682 100 µL

KRT14 Antibody

Sign In for Pricing
View Details
HSPA6 antibody
70R-3829 50 ug

HSPA6 antibody

Sign In for Pricing
View Details
STIM1 Rabbit pAb, PE-Cy5.5 conjugated
orb2865649 100 µL

STIM1 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
EMC1 (2F3) Monoclonal Antibody, AbBy Fluor™ 405 Conjugated
bsm-2279M-BF405 100 µL

EMC1 (2F3) Monoclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Alpha 1 Antitrypsin Mouse Monoclonal Antibody
orb334222 100 µg

Alpha 1 Antitrypsin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
OR4F5 (NM_001005484) Human Tagged ORF Clone Lentiviral Particle
RC214808L4V 200 µL

OR4F5 (NM_001005484) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details