Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METAP1D Peptide - N-terminal region

METAP1D Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAP1D, Metap1l

UniProt

Q6UB28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with METAP1D Rabbit Polyclonal Antibody (orb326886) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954697

Preservative

Lyophilized powder

AA Sequence

LNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Slit Homolog 1 (SLIT1) Protein
abx069113-01 10 µg

Human Slit Homolog 1 (SLIT1) Protein

Sign In for Pricing
View Details
Human Slit Homolog 1 (SLIT1) Protein
abx069113-02 50 µg

Human Slit Homolog 1 (SLIT1) Protein

Sign In for Pricing
View Details
Human Slit Homolog 1 (SLIT1) Protein
abx069113-03 100 µg

Human Slit Homolog 1 (SLIT1) Protein

Sign In for Pricing
View Details
Human Slit Homolog 1 (SLIT1) Protein
abx069113-04 200 µg

Human Slit Homolog 1 (SLIT1) Protein

Sign In for Pricing
View Details
Human Slit Homolog 1 (SLIT1) Protein
abx069113-05 500 µg

Human Slit Homolog 1 (SLIT1) Protein

Sign In for Pricing
View Details
FGFR3 Protein, Cynomolgus, Rhesus, Recombinant (His)
TMPY-00257-01 5 µg

FGFR3 Protein, Cynomolgus, Rhesus, Recombinant (His)

Sign In for Pricing
View Details