Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METAP1D Peptide - N-terminal region

METAP1D Peptide - N-terminal region

Product Specifications

Product Name Alternative

MAP1D, Metap1l

UniProt

Q6UB28

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with METAP1D Rabbit Polyclonal Antibody (orb326886) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954697

Preservative

Lyophilized powder

AA Sequence

LNHIYLHKQSSSQQRRNFFFRRQRDISHSIVLPAAVSSAHPVPKHIKKPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin anti-mouse IgG1
GT17790 500 µg

Biotin anti-mouse IgG1

Sign In for Pricing
View Details
Quantifoil™ R 0.6/1 on 300 copper mesh
X-100-CU300 100 PCS

Quantifoil™ R 0.6/1 on 300 copper mesh

Sign In for Pricing
View Details
Lentiviral human TRAPPC2B sgRNA gene knockout kit - Lentiviral human TRAPPC2B sgRNA gene knockout kit (plasmid)
GTR15399503 1 Vial

Lentiviral human TRAPPC2B sgRNA gene knockout kit - Lentiviral human TRAPPC2B sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
4930432K21Rik (NM_029045) Mouse Recombinant Protein
E45M45539M5 20 µg

4930432K21Rik (NM_029045) Mouse Recombinant Protein

Sign In for Pricing
View Details
RSPO4 (NM_001029871) Human Tagged Lenti ORF Clone
RC224295L2 10 µg

RSPO4 (NM_001029871) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MID-1
MBS3612626-01 5 mg

MID-1

Sign In for Pricing
View Details