Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl11a Peptide - C-terminal region

Bcl11a Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810047E18Rik, BCL-11A, Ctip1, D930021L15Rik, Evi9, mKIAA1809

UniProt

Q5STS7

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcl11a Rabbit Polyclonal Antibody (orb573695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001152761

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit
SEKM-0388-01 48 Tests

Mouse hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit
SEKM-0388-02 96 Tests

Mouse hs-CRP (high-sensitivity C-Reactive Protein) ELISA Kit

Sign In for Pricing
View Details
BARD1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
13012126 3x 1.0µg DNA

BARD1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
LGALS7 Recombinant Protein N-GST Tag Lyophilized 100UG
IHULGALS7RNGSTLY100UG 100 µg

LGALS7 Recombinant Protein N-GST Tag Lyophilized 100UG

Sign In for Pricing
View Details
DSCR9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
18621061 1.0 µg DNA

DSCR9 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Fmoc-Met-Wang resin (200-400 mesh, 0.50-1.10 mmol/g)
D-1120.0025 25.0g

Fmoc-Met-Wang resin (200-400 mesh, 0.50-1.10 mmol/g)

Sign In for Pricing
View Details