Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bcl11a Peptide - C-terminal region

Bcl11a Peptide - C-terminal region

Product Specifications

Product Name Alternative

2810047E18Rik, BCL-11A, Ctip1, D930021L15Rik, Evi9, mKIAA1809

UniProt

Q5STS7

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bcl11a Rabbit Polyclonal Antibody (orb573695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001152761

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLRIYLESEHGSPLTPRVLHTPPFGVVPRELKMCGSFRMEAQEPLSSEKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Deazauridine-5'-triphosphate Triethylamine Salt
425316-01 2.5 mg

3-Deazauridine-5'-triphosphate Triethylamine Salt

Sign In for Pricing
View Details
3-Deazauridine-5'-triphosphate Triethylamine Salt
425316-02 25 mg

3-Deazauridine-5'-triphosphate Triethylamine Salt

Sign In for Pricing
View Details
5-Bromo-2-mercaptoquinazolin-4 (3H) -one
OR300269 250 mg

5-Bromo-2-mercaptoquinazolin-4 (3H) -one

Sign In for Pricing
View Details
Thyroxine ELISA Kit (Chicken)
OKCA00265-96W 96 Well

Thyroxine ELISA Kit (Chicken)

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans ATP phosphoribosyltransferase (hisG)
MBS1026364-01 0.02 mg (E-Coli)

Recombinant Desulfococcus oleovorans ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details
Recombinant Desulfococcus oleovorans ATP phosphoribosyltransferase (hisG)
MBS1026364-02 0.02 mg (Yeast)

Recombinant Desulfococcus oleovorans ATP phosphoribosyltransferase (hisG)

Sign In for Pricing
View Details