Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prdm4 Peptide - C-terminal region

Prdm4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700031E19Rik, 2810470D21Rik, AW552272, SC-1

UniProt

Q80V63

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prdm4 Rabbit Polyclonal Antibody (orb573831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_857633

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-Difluoro U-48800 Hydrochloride
TRC-D956230-100MG 100 mg

2,4-Difluoro U-48800 Hydrochloride

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708255 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
2-Pyridineboronic Acid
TRC-P991340-250MG 250 mg

2-Pyridineboronic Acid

Sign In for Pricing
View Details
WDR58 (THOC6) Rabbit Polyclonal Antibody
TA382506 100 µL

WDR58 (THOC6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human WFDC8 activation kit by CRISPRa
GA113987 1 Kit

Human WFDC8 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human IL17RC Protein (aa 1-454, His Tag)
PKSH031012 100 µg

Recombinant Human IL17RC Protein (aa 1-454, His Tag)

Sign In for Pricing
View Details