Prdm4 Peptide - C-terminal region
Prdm4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
1700031E19Rik, 2810470D21Rik, AW552272, SC-1
UniProt
Q80V63
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Prdm4 Rabbit Polyclonal Antibody (orb573831) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_857633
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY402765 100 µg
KTEL1 (POGLUT1) (NM_020231) Human Over-expression Lysate
Sign In for Pricing
View Details 
LC422905 20 µg
Gemin 2 (GEMIN2) (NM_001009183) Human Over-expression Lysate
Sign In for Pricing
View Details 
