Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb7c Peptide - middle region

Zbtb7c Peptide - middle region

Product Specifications

Product Name Alternative

B230208J24Rik, Kr-pok, Zbtb36

UniProt

Q8VCZ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zbtb7c Rabbit Polyclonal Antibody (orb573876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663331

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDITCPQSPSKTDHLTEKDYSDTPRDFPDSFQPGSPGHLGVIRDFSIESL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2S,3R) -H-Abu (3-N3) -OH (hydrochloride)
HY-151836 1 Each

(2S,3R) -H-Abu (3-N3) -OH (hydrochloride)

Sign In for Pricing
View Details
ZNF79 Antibody (N-term) Blocking Peptide
MBS9223072-01 0.5 mg

ZNF79 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
ZNF79 Antibody (N-term) Blocking Peptide
MBS9223072-02 5x 0.5 mg

ZNF79 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
RASSF1 Mouse Monoclonal Antibody [Clone ID: OTI8E2]
CF502486 100 µg

RASSF1 Mouse Monoclonal Antibody [Clone ID: OTI8E2]

Sign In for Pricing
View Details
Mouse Calmodulin-binding transcription activator 1 (CAMTA1) ELISA Kit
abx507460 96 Tests

Mouse Calmodulin-binding transcription activator 1 (CAMTA1) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human APOE Protein, C-His (Active)
AHB98601 100 μg

Recombinant Human APOE Protein, C-His (Active)

Sign In for Pricing
View Details