Zbtb7c Peptide - middle region
Zbtb7c Peptide - middle region
Product Specifications
Product Name Alternative
B230208J24Rik, Kr-pok, Zbtb36
UniProt
Q8VCZ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zbtb7c Rabbit Polyclonal Antibody (orb573876) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_663331
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QDITCPQSPSKTDHLTEKDYSDTPRDFPDSFQPGSPGHLGVIRDFSIESL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
ARP51197_P050-HRP 100 µL
MAS1 Antibody - middle region : HRP (ARP51197_P050-HRP)
Sign In for Pricing
View Details 
EIA07634Rb 1 Kit
Rabbit Chemokine (C-C motif) ligand 24 (CCL24) ELISA Kit
Sign In for Pricing
View Details 
25415156 3x 1.0 µg DNA
KCNN3 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Sign In for Pricing
View Details 
MBS6410391-01 0.1 mL
CD58 (CD58 Antigen, Lymphocyte Function Associated Antigen Type 3, AG3, LFA3, LFA-3) (PE)
Sign In for Pricing
View Details