LOC100360880 Peptide - N-terminal region
LOC100360880 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Fosb, fra-2, LOC100360880
UniProt
D3ZLB7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LOC100360880 Rabbit Polyclonal Antibody (orb324389) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_002725585
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 