Nfia Peptide - middle region
Nfia Peptide - middle region
Product Specifications
Product Name Alternative
1110047K16Rik, 9430022M17Rik, NF1-A, NF1A
UniProt
Q02780
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Nfia Rabbit Polyclonal Antibody (orb574026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001116424
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-90321AF647 0.1 mL
Rabbit Monoclonal Proapoptotic Caspase Adaptor Protein Antibody (055) [Alexa Fluor 647]
Sign In for Pricing
View Details 