Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rora Peptide - middle region

Rora Peptide - middle region

Product Specifications

Product Name Alternative

9530021D13Rik, Nr1f1, ROR1, ROR2, ROR3, nmf267, sg, staggerer, tmgc26

UniProt

P51448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rora Rabbit Polyclonal Antibody (orb329791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038674

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-human CD127
FC0773 100 Tests

PE anti-human CD127

Sign In for Pricing
View Details
RNU6-55 Protein Vector (Human) (pPB-N-His)
PV118887 500 ng

RNU6-55 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Mouse IgM, Human ads Antibody : TRITC
OASB01463-1MG 1 mg

Mouse IgM, Human ads Antibody : TRITC

Sign In for Pricing
View Details
Mouse Monoclonal CD45RA Antibody (SPM568) [DyLight 405]
NBP2-34802V 0.1 mL

Mouse Monoclonal CD45RA Antibody (SPM568) [DyLight 405]

Sign In for Pricing
View Details
HCV Nucleocapsid/NS3/NS4/NS5
GWB-9F343E 1 mg

HCV Nucleocapsid/NS3/NS4/NS5

Sign In for Pricing
View Details
OAZ (B-7) : m-IgG Fc BP-HRP Bundle
sc-527937 1 Kit

OAZ (B-7) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details