Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rora Peptide - middle region

Rora Peptide - middle region

Product Specifications

Product Name Alternative

9530021D13Rik, Nr1f1, ROR1, ROR2, ROR3, nmf267, sg, staggerer, tmgc26

UniProt

P51448

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rora Rabbit Polyclonal Antibody (orb329791) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_038674

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-34 Lentiviral Activation Particles (h2)
sc-404640-LAC-2 200 µL

IL-34 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
SLC34A1 siRNA (Human)
CRH4458-01 15 nmol

SLC34A1 siRNA (Human)

Sign In for Pricing
View Details
SLC34A1 siRNA (Human)
CRH4458-02 30 nmol

SLC34A1 siRNA (Human)

Sign In for Pricing
View Details
Quinaldine
20573190 100 g

Quinaldine

Sign In for Pricing
View Details
Magic™ Membrane Protein Human FITM2 (Fat storage inducing transmembrane protein 2) Expressed in vitro E.coli expression system, Full Length
MPX2650K Each

Magic™ Membrane Protein Human FITM2 (Fat storage inducing transmembrane protein 2) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
Scgb2b24 (NM_177446) Mouse Untagged Clone
MC212963 10 µg

Scgb2b24 (NM_177446) Mouse Untagged Clone

Sign In for Pricing
View Details