Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp27 Peptide - middle region

Zfp27 Peptide - middle region

Product Specifications

Product Name Alternative

Zfp-27, mkr-4, mszf76

UniProt

P10077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp27 Rabbit Polyclonal Antibody (orb575860) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032796

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRRIHTGEKLYDCSHCGKGFSYNSDLRIHQKIHTGEKRHGCVDCGKAFTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF266 (NM_006631) Human Tagged ORF Clone Lentiviral Particle
RC214828L4V 200 µL

ZNF266 (NM_006631) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal SARS Spike Protein Antibody (17F706R) [mFluor Violet 610 SE]
NBP2-90999MFV610 0.1 mL

Mouse Monoclonal SARS Spike Protein Antibody (17F706R) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
AGA Antibody
orb519837-01 50 μL

AGA Antibody

Sign In for Pricing
View Details
AGA Antibody
orb519837-02 100 µL

AGA Antibody

Sign In for Pricing
View Details
ENTPD5 Peptide - N-terminal region
MBS3240353-01 0.1 mg

ENTPD5 Peptide - N-terminal region

Sign In for Pricing
View Details
ENTPD5 Peptide - N-terminal region
MBS3240353-02 5x 0.1 mg

ENTPD5 Peptide - N-terminal region

Sign In for Pricing
View Details