Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp27 Peptide - middle region

Zfp27 Peptide - middle region

Product Specifications

Product Name Alternative

Zfp-27, mkr-4, mszf76

UniProt

P10077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp27 Rabbit Polyclonal Antibody (orb575860) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032796

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRRIHTGEKLYDCSHCGKGFSYNSDLRIHQKIHTGEKRHGCVDCGKAFTQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSD-CH2 (1,8) -NH2
T80421-01 5 mg

CSD-CH2 (1,8) -NH2

Sign In for Pricing
View Details
CSD-CH2 (1,8) -NH2
T80421-02 50 mg

CSD-CH2 (1,8) -NH2

Sign In for Pricing
View Details
RAD51 Homolog (RAD51) Magnetic Luminex Assay Kit
LKU606959 96 Tests

RAD51 Homolog (RAD51) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Human PGF2a ELISA Kit
EHP0659 96 Tests

Human PGF2a ELISA Kit

Sign In for Pricing
View Details
rHu IL-33
AK8290-0010 10µg

rHu IL-33

Sign In for Pricing
View Details
LEPRE1 (P3H1) (NM_001146289) Human Tagged Lenti ORF Clone
RC229000L4 10 µg

LEPRE1 (P3H1) (NM_001146289) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details