Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lhx9 Peptide - C-terminal region

Lhx9 Peptide - C-terminal region

Product Specifications

Product Name Alternative

3110009O07Rik, BB104635, LH2B

UniProt

Q9WUH2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lhx9 Rabbit Polyclonal Antibody (orb576207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001020736

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLRTMKSYFAINHNPDAKDLKQLAQKTGLTKRVLQGEQILGHYSQTSRRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Protein Kinase R (PKR) ELISA Kit
DLR-PKR-Hu-48T 48 Tests

Human Protein Kinase R (PKR) ELISA Kit

Sign In for Pricing
View Details
ZFN1 Antibody
orb785370 2 mg

ZFN1 Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human LY75 pAb
PA4669-01 50 μL

Rabbit Anti-Human LY75 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human LY75 pAb
PA4669-02 100 μL

Rabbit Anti-Human LY75 pAb

Sign In for Pricing
View Details
SLC13A2 Protein Vector (Human) (pPM-C-HA)
PV057803 500 ng

SLC13A2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
NIPBL antibody
orb618876 100 µL

NIPBL antibody

Sign In for Pricing
View Details