Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Msx3 Peptide - C-terminal region

Msx3 Peptide - C-terminal region

Product Specifications

UniProt

G3V8C7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Msx3 Rabbit Polyclonal Antibody (orb576211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446164

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal TBCA Antibody (1A5) [Janelia Fluor 646]
NBP1-30168JF646 0.1 mL

Mouse Monoclonal TBCA Antibody (1A5) [Janelia Fluor 646]

Sign In for Pricing
View Details
Rabbit Polyclonal LIMD1 Antibody
NBP1-71937 0.1 mL

Rabbit Polyclonal LIMD1 Antibody

Sign In for Pricing
View Details
ELISA kit for Rat Death-associated protein kinase 3 (DAPK3)
KTE100796-01 48 Tests

ELISA kit for Rat Death-associated protein kinase 3 (DAPK3)

Sign In for Pricing
View Details
ELISA kit for Rat Death-associated protein kinase 3 (DAPK3)
KTE100796-02 96 Tests

ELISA kit for Rat Death-associated protein kinase 3 (DAPK3)

Sign In for Pricing
View Details
ELISA kit for Rat Death-associated protein kinase 3 (DAPK3)
KTE100796-03 5x 96 Well

ELISA kit for Rat Death-associated protein kinase 3 (DAPK3)

Sign In for Pricing
View Details
P27Kip1 (Phospho-Thr187) Antibody
ABM0292 100 µL

P27Kip1 (Phospho-Thr187) Antibody

Sign In for Pricing
View Details