Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Msx3 Peptide - C-terminal region

Msx3 Peptide - C-terminal region

Product Specifications

UniProt

G3V8C7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Msx3 Rabbit Polyclonal Antibody (orb576211) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_446164

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKLKLTAKPLLPAAFALPFPLGTQLHSSAATFGGNAVPGILAGPVAAYGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASMT (Acetylserotonin O-Methyltransferase, Hydroxyindole O-methyltransferase, HIOMT)
123623 100 µg

ASMT (Acetylserotonin O-Methyltransferase, Hydroxyindole O-methyltransferase, HIOMT)

Sign In for Pricing
View Details
Aculeacin A discontinued
440951-01 1 mg

Aculeacin A discontinued

Sign In for Pricing
View Details
Aculeacin A discontinued
440951-02 2.5 mg

Aculeacin A discontinued

Sign In for Pricing
View Details
pCMV-SPORT6-ARG2 Plasmid
PVT16319 2 µg

pCMV-SPORT6-ARG2 Plasmid

Sign In for Pricing
View Details
MAT1A Antibody
OAAN01926-100UL 100 µL

MAT1A Antibody

Sign In for Pricing
View Details
Bcl-2 Antibody
orb749299-01 20 µg

Bcl-2 Antibody

Sign In for Pricing
View Details