Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbx5 Peptide - N-terminal region

Tbx5 Peptide - N-terminal region

Product Specifications

UniProt

P70326

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbx5 Rabbit Polyclonal Antibody (orb576222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035667

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primer Panel
HPP6021C 20x 96 Pre-Arrayed Plates

Primer Panel

Sign In for Pricing
View Details
Cenpo Mouse Gene Knockout Kit (CRISPR)
KN503136 1 Kit

Cenpo Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KDM6B (NM_001080424) Human Recombinant Protein
TP762304 50 µg

KDM6B (NM_001080424) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS801971 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Direct Blue 218 (Technical Grade)
TRC-D492970-5G 5 g

Direct Blue 218 (Technical Grade)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD156c (ADAM10) Antibody[11G2]
AN00355J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD156c (ADAM10) Antibody[11G2]

Sign In for Pricing
View Details