Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tbx5 Peptide - N-terminal region

Tbx5 Peptide - N-terminal region

Product Specifications

UniProt

P70326

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tbx5 Rabbit Polyclonal Antibody (orb576222) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035667

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc finger MIZ domain containing protein 1 (ZMIZ1) (NM_020338) Human Over-expression Lysate
LC402770 20 µg

Zinc finger MIZ domain containing protein 1 (ZMIZ1) (NM_020338) Human Over-expression Lysate

Sign In for Pricing
View Details
HACE1 Mouse Monoclonal Antibody [Clone ID: OTI10D3]
CF810113 100 µg

HACE1 Mouse Monoclonal Antibody [Clone ID: OTI10D3]

Sign In for Pricing
View Details
DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]
TA503959AM 100 µL

DPP9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D4]

Sign In for Pricing
View Details
C19orf63 (EMC10) Rabbit Polyclonal Antibody
TA367907 100 µL

C19orf63 (EMC10) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(-)Sophoridine
TRC-S676840-1G 1 g

(-)Sophoridine

Sign In for Pricing
View Details
FOXO3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F11]
TA809449AM 100 µL

FOXO3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F11]

Sign In for Pricing
View Details