Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uncx Peptide - N-terminal region

Uncx Peptide - N-terminal region

Product Specifications

Product Name Alternative

Chx4, PHD1, Uncx4.1

UniProt

P97830

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Uncx Rabbit Polyclonal Antibody (orb576236) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_058875

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVNPTPLLPAACGVAGESQPFKLADSGDPDKESPGCKRRRTRTNFTGWQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RSRC1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
42803064 1.0 µg DNA

RSRC1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Human Neuropilin-1 protein, C-Fc Tag
MBS1562946-01 0.05 mg

Recombinant Human Neuropilin-1 protein, C-Fc Tag

Sign In for Pricing
View Details
Recombinant Human Neuropilin-1 protein, C-Fc Tag
MBS1562946-02 0.1 mg

Recombinant Human Neuropilin-1 protein, C-Fc Tag

Sign In for Pricing
View Details
Recombinant Human Neuropilin-1 protein, C-Fc Tag
MBS1562946-03 5x 0.1 mg

Recombinant Human Neuropilin-1 protein, C-Fc Tag

Sign In for Pricing
View Details
Mortars And Pestles, Glass
2065670/3 1 Each

Mortars And Pestles, Glass

Sign In for Pricing
View Details
PLV3-CMV-Marf1-3xFLAG-CopGFP-Puro Plasmid
PVT71908 2 µg

PLV3-CMV-Marf1-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details