Rybp Peptide - N-terminal region
Rybp Peptide - N-terminal region
Product Specifications
Product Name Alternative
2410018J24Rik, DEDAF, YEAF1
UniProt
Q8CCI5
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rybp Rabbit Polyclonal Antibody (orb576262) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062717
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RINSQLVAQQVAQQYATPPPPKKEKKEKVEKPDKEKPEKDKDISPSVTKK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSH032243-01 10 µg
Recombinant Human CGREF1/CGR11 Protein (His Tag)
Sign In for Pricing
View Details PKSH032243-02 50 µg
Recombinant Human CGREF1/CGR11 Protein (His Tag)
Sign In for Pricing
View Details ![NDUFA7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B2]](https://cdn.genprice.uk/products/937/6868c334994c49e6dc3f1c7a/imageurl/ta502656am.webp)
TA502656AM 100 µL
NDUFA7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3B2]
Sign In for Pricing
View Details 
