Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Taf1a Peptide - N-terminal region

Taf1a Peptide - N-terminal region

Product Specifications

UniProt

Q3B7U2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Taf1a Rabbit Polyclonal Antibody (orb576271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032281

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FARSLA Antibody
NBP3-03569-20ul 20 µL

Rabbit Polyclonal FARSLA Antibody

Sign In for Pricing
View Details
AMPK beta 2 (PRKAB2) Human siRNA Oligo Duplex (Locus ID 5565)
SR303724 1 Kit

AMPK beta 2 (PRKAB2) Human siRNA Oligo Duplex (Locus ID 5565)

Sign In for Pricing
View Details
TLK1 Protein Vector (Mouse) (pPM-C-HA)
PV238576 500 ng

TLK1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TAX1BP1 Antibody, FITC conjugated
MBS7107369-01 0.05 mg

TAX1BP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
TAX1BP1 Antibody, FITC conjugated
MBS7107369-02 0.1 mg

TAX1BP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
TAX1BP1 Antibody, FITC conjugated
MBS7107369-03 5x 0.1 mg

TAX1BP1 Antibody, FITC conjugated

Sign In for Pricing
View Details