Taf1a Peptide - N-terminal region
Taf1a Peptide - N-terminal region
Product Specifications
UniProt
Q3B7U2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Taf1a Rabbit Polyclonal Antibody (orb576271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032281
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FAQTTSACLSFLQEALLKHQWCRAAEYMHSYLQTLEDSDTYRKQAAPEII
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15141244 1 Vial
Lentiviral human TBC1D8B shRNA (UAS) - Lentiviral human TBC1D8B shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
CST 33033S 100 µL
Phospho-CD79A (Tyr210) (E8E9Z) Rabbit Monoclonal Antibody (Alexa Fluor® 647 Conjugate)
Sign In for Pricing
View Details