Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsfy2 Peptide - C-terminal region

Hsfy2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4933413G11Rik, Hspy2l

UniProt

Q80Y37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsfy2 Rabbit Polyclonal Antibody (orb324693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081937

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSDFSLATP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adenylate Cyclase 5/6 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5, ADCY5) (MaxLight 405) discontinued
302250-ML405 100 µL

Adenylate Cyclase 5/6 (Adenylate Cyclase Type 5, ATP Pyrophosphate-lyase 5, Adenylate Cyclase Type V, Adenylyl Cyclase 5, ADCY5) (MaxLight 405) discontinued

Sign In for Pricing
View Details
DCTN5 Human Over-expression Lysate
orb1351639 100 µg

DCTN5 Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)
MBS7099671-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)
MBS7099671-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)
MBS7099671-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)
MBS7099671-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Phytosulfokines 5 (PSK5)

Sign In for Pricing
View Details