Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hsfy2 Peptide - C-terminal region

Hsfy2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4933413G11Rik, Hspy2l

UniProt

Q80Y37

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hsfy2 Rabbit Polyclonal Antibody (orb324693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081937

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSDFSLATP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NMNAT2, NT (NMNAT2, C1orf15, KIAA0479, Nicotinamide mononucleotide adenylyltransferase 2, Nicotinate-nucleotide adenylyltransferase 2) (Azide free) (HRP)
MBS6325866-01 0.2 mL

NMNAT2, NT (NMNAT2, C1orf15, KIAA0479, Nicotinamide mononucleotide adenylyltransferase 2, Nicotinate-nucleotide adenylyltransferase 2) (Azide free) (HRP)

Sign In for Pricing
View Details
NMNAT2, NT (NMNAT2, C1orf15, KIAA0479, Nicotinamide mononucleotide adenylyltransferase 2, Nicotinate-nucleotide adenylyltransferase 2) (Azide free) (HRP)
MBS6325866-02 5x 0.2 mL

NMNAT2, NT (NMNAT2, C1orf15, KIAA0479, Nicotinamide mononucleotide adenylyltransferase 2, Nicotinate-nucleotide adenylyltransferase 2) (Azide free) (HRP)

Sign In for Pricing
View Details
Interferon Gamma Induced Protein 10kDa (IP10) Monoclonal Antibody
CAU36927-01 100 µL

Interferon Gamma Induced Protein 10kDa (IP10) Monoclonal Antibody

Sign In for Pricing
View Details
Interferon Gamma Induced Protein 10kDa (IP10) Monoclonal Antibody
CAU36927-02 200 µL

Interferon Gamma Induced Protein 10kDa (IP10) Monoclonal Antibody

Sign In for Pricing
View Details
Interferon Gamma Induced Protein 10kDa (IP10) Monoclonal Antibody
CAU36927-03 1 mL

Interferon Gamma Induced Protein 10kDa (IP10) Monoclonal Antibody

Sign In for Pricing
View Details
SAMD9 Polyclonal Antibody, Cy5 Conjugated
bs-9002R-Cy5 100 µL

SAMD9 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details