Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxp3 Peptide - N-terminal region

Foxp3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

JM2, scurfin, sf

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxp3 Rabbit Polyclonal Antibody (orb576306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-O-Isopropylidene-a-D-glucofuranose
I9040-88 2.5 g

1,2-O-Isopropylidene-a-D-glucofuranose

Sign In for Pricing
View Details
Cofilin 1 (CFL1) Antibody
abx403569-01 100 µL

Cofilin 1 (CFL1) Antibody

Sign In for Pricing
View Details
Cofilin 1 (CFL1) Antibody
abx403569-02 200 µL

Cofilin 1 (CFL1) Antibody

Sign In for Pricing
View Details
Cofilin 1 (CFL1) Antibody
abx403569-03 1 mL

Cofilin 1 (CFL1) Antibody

Sign In for Pricing
View Details
ROMO1 Antibody
orb1282015 100 µL

ROMO1 Antibody

Sign In for Pricing
View Details
ARS2 (m) -PR
sc-141277-PR 10 µM - 20 µL

ARS2 (m) -PR

Sign In for Pricing
View Details