Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxp3 Peptide - N-terminal region

Foxp3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

JM2, scurfin, sf

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxp3 Rabbit Polyclonal Antibody (orb576306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473380

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADP Ribosylation Factor-Like 2 Binding Protein (ARL2BP) Antibody
abx332578 100 µL

ADP Ribosylation Factor-Like 2 Binding Protein (ARL2BP) Antibody

Sign In for Pricing
View Details
Anti-CD40 Antibody
CPA1185-01 30 µL

Anti-CD40 Antibody

Sign In for Pricing
View Details
Anti-CD40 Antibody
CPA1185-02 50 μL

Anti-CD40 Antibody

Sign In for Pricing
View Details
Anti-CD40 Antibody
CPA1185-03 100 µL

Anti-CD40 Antibody

Sign In for Pricing
View Details
Anti-CD40 Antibody
CPA1185-04 200 µL

Anti-CD40 Antibody

Sign In for Pricing
View Details
TRIM26 Rabbit Polyclonal Antibody (FITC)
orb2100852 100 µL

TRIM26 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details