Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vgll2 Peptide - C-terminal region

Vgll2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C130057C21Rik, VITO-1, Vito1

UniProt

Q8BGW8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vgll2 Rabbit Polyclonal Antibody (orb576465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722481

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SELPFATDPYSPATLHGHLHQGAADWHHAHPHHAHPHHPYALGGALGAQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D2 (C-term) Rabbit Polyclonal Antibody
AP54437PU-N 400 µL

UBE2D2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Annexin A11 (ANXA11) (NM_001157) Human Over-expression Lysate
LY420097 100 µg

Annexin A11 (ANXA11) (NM_001157) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rb (phospho T252) Antibody
RC-5591-01 50 μL

Recombinant Rb (phospho T252) Antibody

Sign In for Pricing
View Details
Recombinant Rb (phospho T252) Antibody
RC-5591-02 100 µL

Recombinant Rb (phospho T252) Antibody

Sign In for Pricing
View Details
Recombinant Rb (phospho T252) Antibody
RC-5591-03 1 mL

Recombinant Rb (phospho T252) Antibody

Sign In for Pricing
View Details
Dnmt2 Recombinant Rabbit monoclonal Antibody
HA750877 100 µL

Dnmt2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details