Vgll2 Peptide - C-terminal region
Vgll2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C130057C21Rik, VITO-1, Vito1
UniProt
Q8BGW8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Vgll2 Rabbit Polyclonal Antibody (orb576465) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_722481
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SELPFATDPYSPATLHGHLHQGAADWHHAHPHHAHPHHPYALGGALGAQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PKC alpha Recombinant Rabbit Monoclonal Antibody [SU31-08]](https://cdn.genprice.uk/products/992/68dd1c8b061270361ea81687/imageurl/et1608-15.webp)
ET1608-15 100 µL
PKC alpha Recombinant Rabbit Monoclonal Antibody [SU31-08]
Sign In for Pricing
View Details 
BNC682494-100 1x 100 µL
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2494), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 