Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Klf3 Peptide - N-terminal region

Klf3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9930027G08Rik, AL024007, Bklf, Tef-2

UniProt

Q60980

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Klf3 Rabbit Polyclonal Antibody (orb577031) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_032479

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THAP8 Mouse Monoclonal Antibody [Clone ID: OTI4F7]
CF811425 100 µg

THAP8 Mouse Monoclonal Antibody [Clone ID: OTI4F7]

Sign In for Pricing
View Details
PLEKHD1 Human Gene Knockout Kit (CRISPR)
KN428935 1 Kit

PLEKHD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TMEM170B Human Gene Knockout Kit (CRISPR)
KN415469 1 Kit

TMEM170B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRP94 Antibody
OC-976-01 50 μL

GRP94 Antibody

Sign In for Pricing
View Details
GRP94 Antibody
OC-976-02 100 µL

GRP94 Antibody

Sign In for Pricing
View Details
GRP94 Antibody
OC-976-03 1 mL

GRP94 Antibody

Sign In for Pricing
View Details