Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Larp4b Peptide - middle region

Larp4b Peptide - middle region

Product Specifications

Product Name Alternative

A630096F19, AI256361, D13Wsu64e, Larp5

UniProt

Q6A0A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Larp4b Rabbit Polyclonal Antibody (orb577783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766173

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CXCL12/SDF-1 beta Protein
orb3002212-01 10 µg

Recombinant Human CXCL12/SDF-1 beta Protein

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 beta Protein
orb3002212-02 50 µg

Recombinant Human CXCL12/SDF-1 beta Protein

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 beta Protein
orb3002212-03 500 µg

Recombinant Human CXCL12/SDF-1 beta Protein

Sign In for Pricing
View Details
Recombinant Human CXCL12/SDF-1 beta Protein
orb3002212-04 1 mg

Recombinant Human CXCL12/SDF-1 beta Protein

Sign In for Pricing
View Details
Human IRF1 ELISA Kit
CEK2535 96 Tests

Human IRF1 ELISA Kit

Sign In for Pricing
View Details
Mouse Tmem248 Pre-designed siRNA Set B
SI114870B 1 Each

Mouse Tmem248 Pre-designed siRNA Set B

Sign In for Pricing
View Details