Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Larp4b Peptide - middle region

Larp4b Peptide - middle region

Product Specifications

Product Name Alternative

A630096F19, AI256361, D13Wsu64e, Larp5

UniProt

Q6A0A2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Larp4b Rabbit Polyclonal Antibody (orb577783) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_766173

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ENNDTGGNESQPESQEDPREVLKKTLEFCLSRENLASDMYLISQMDSDQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD109 Protein, C-His
orb2834236-01 20 µg

Recombinant Human CD109 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD109 Protein, C-His
orb2834236-02 50 µg

Recombinant Human CD109 Protein, C-His

Sign In for Pricing
View Details
Recombinant Human CD109 Protein, C-His
orb2834236-03 100 µg

Recombinant Human CD109 Protein, C-His

Sign In for Pricing
View Details
Overhead Stirrer (BER-4103)
BER-4103 1 Unit

Overhead Stirrer (BER-4103)

Sign In for Pricing
View Details
LRP12 3'UTR GFP Stable Cell Line
TU062625 1.0 mL

LRP12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Endo-BCN-PEG4-PFP ester
HY-140073-01 5 mg

Endo-BCN-PEG4-PFP ester

Sign In for Pricing
View Details