Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbm28 Peptide - C-terminal region

Rbm28 Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbm28 Rabbit Polyclonal Antibody (orb577822) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH18373

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QKKQQLASSVQAPKRKAKENKAEARFNQLVEQYKQKLLGPSKGAPLMKRS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L1td1 (NM_001081202) Mouse Tagged ORF Clone
MR218754 10 µg

L1td1 (NM_001081202) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Dact3 (NM_001081655) AAV Particle
MR222704A1V 250 µL

Mouse Dact3 (NM_001081655) AAV Particle

Sign In for Pricing
View Details
Anti-TCR (NKTT320)
C00785-01 1 mg

Anti-TCR (NKTT320)

Sign In for Pricing
View Details
Anti-TCR (NKTT320)
C00785-02 5x 1 mg

Anti-TCR (NKTT320)

Sign In for Pricing
View Details
Anti-TCR (NKTT320)
C00785-03 25x 1 mg

Anti-TCR (NKTT320)

Sign In for Pricing
View Details
N-[4- (Aminomethyl) phenyl]pyridine-4-carboxamide
BMB21181-01 250 mg

N-[4- (Aminomethyl) phenyl]pyridine-4-carboxamide

Sign In for Pricing
View Details